PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4533_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 27919.9 Da    PI: 9.1357
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4533_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Neem_4533_f_2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                   79***********************************************96 PP

2K-box95.96.2e-32821739100
          K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                    + +++ es+++e+ kLk + e Lqr+qR+llGedL++L  keL+qLe+qLe+slk++Rs+K++++l+q+ +lq+ke+ l e+n+aL+ kl+e
  Neem_4533_f_2  82 KPAKELESSYREYLKLKTRFEALQRTQRNLLGEDLGPLGSKELEQLERQLESSLKHVRSTKTQFMLDQLADLQNKEQLLLEANRALTVKLDE 173
                    4567899********************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.557161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-34278IPR002100Transcription factor, MADS-box
CDDcd002651.92E-45276No hitNo description
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-2685171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.97487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
NSMLKTLDRY QKCSYGAVEV NKPAKELESS YREYLKLKTR FEALQRTQRN LLGEDLGPLG  120
SKELEQLERQ LESSLKHVRS TKTQFMLDQL ADLQNKEQLL LEANRALTVK LDEMNTKTQL  180
RQTWEGSEQH IAYNPQHPQT QGLFQPIECN PTLQIGYNPS CSDQMTATTA GQQVNGFLPG  240
WML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-35751711101Developmental protein SEPALLATA 3
4ox0_B2e-35751711101Developmental protein SEPALLATA 3
4ox0_C2e-35751711101Developmental protein SEPALLATA 3
4ox0_D2e-35751711101Developmental protein SEPALLATA 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9474642e-57AY947464.1 Prunus dulcis MADS-box transcription factor (MADS3) mRNA, complete cds.
GenBankEF4403522e-57EF440352.1 Prunus persica transcription factor MADS7 (MADS7) mRNA, complete cds.
GenBankJQ6867252e-57JQ686725.1 Prunus avium transcription factor MADS4 (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430949.11e-166hypothetical protein CICLE_v10012593mg
SwissprotP293841e-128SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLV4UWS41e-166V4UWS4_9R
STRINGGLYMA13G06730.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32892765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-119MIKC_MADS family protein